Recombinant Full Length Human CD27 Protein, C-Flag-tagged
Cat.No. : | CD27-1418HFL |
Product Overview : | Recombinant Full Length Human CD27 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.9 kDa |
AA Sequence : | MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVS FSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHP QPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALF LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | CD27 CD27 molecule [ Homo sapiens (human) ] |
Official Symbol | CD27 |
Synonyms | T14; S152; Tp55; TNFRSF7; S152. LPFS2 |
Gene ID | 939 |
mRNA Refseq | NM_001242.5 |
Protein Refseq | NP_001233.2 |
MIM | 186711 |
UniProt ID | P26842 |
◆ Recombinant Proteins | ||
CD27-324H | Active Recombinant Human CD27 protein, His-tagged, Biotinylated | +Inquiry |
CD27-556HAF488 | Recombinant Human CD27 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Cd27-840MF | Active Recombinant Mouse Cd27 Protein, His/Fc-tagged, FITC conjugated | +Inquiry |
Cd27-643R | Active Recombinant Rat Cd27, Fc Chimera | +Inquiry |
Cd27-3273MAF555 | Recombinant Mouse Cd27 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD27-1156CCL | Recombinant Cynomolgus CD27 cell lysate | +Inquiry |
CD27-2415MCL | Recombinant Mouse CD27 cell lysate | +Inquiry |
CD27-1383HCL | Recombinant Human CD27 cell lysate | +Inquiry |
CD27-001HCL | Recombinant Human CD27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD27 Products
Required fields are marked with *
My Review for All CD27 Products
Required fields are marked with *
0
Inquiry Basket