Recombinant Full Length Human CD36 Protein, His-tagged
Cat.No. : | CD36-57HF |
Product Overview : | Recombinant full length Human CD36 (amino acids 1-472) with a N terminal His tag; predicted MWt 77.99 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | His |
Protein Length : | 472 amino acids |
Description : | The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 77.990kDa inclusive of tags |
AA Sequence : | MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKK QVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNS SNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNS LINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGL FYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKII SKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPID GLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPS EKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTG KINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CD36 CD36 molecule (thrombospondin receptor) [ Homo sapiens ] |
Official Symbol | CD36 |
Synonyms | CD36; CD36 molecule (thrombospondin receptor); CD36 antigen (collagen type I receptor, thrombospondin receptor); platelet glycoprotein 4; FAT; GP3B; GP4; GPIV; SCARB3 |
Gene ID | 948 |
mRNA Refseq | NM_000072 |
Protein Refseq | NP_000063 |
MIM | 173510 |
UniProt ID | P16671 |
◆ Recombinant Proteins | ||
CD36-001M | Recombinant Monkey CD36 Protein | +Inquiry |
CD36-7084H | Recombinant Human CD36 protein, His & T7-tagged | +Inquiry |
CD36-257H | Recombinant Human CD36 protein, His-tagged | +Inquiry |
CD36-2432C | Recombinant Chicken CD36 | +Inquiry |
Cd36-7170M | Recombinant Mouse Cd36 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD36-1109CCL | Recombinant Cynomolgus CD36 cell lysate | +Inquiry |
CD36-2539HCL | Recombinant Human CD36 cell lysate | +Inquiry |
CD36-2400MCL | Recombinant Mouse CD36 cell lysate | +Inquiry |
CD36-1236RCL | Recombinant Rat CD36 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD36 Products
Required fields are marked with *
My Review for All CD36 Products
Required fields are marked with *
0
Inquiry Basket