Recombinant Full Length Human CD3E Protein
Cat.No. : | CD3E-62HF |
Product Overview : | Recombinant full length mature Human CD3 epsilon with N terminal proprietary tag; predicted MWt 46.46 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 185 amino acids |
Description : | The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. |
Form : | Liquid |
Molecular Mass : | 46.460kDa inclusive of tags |
AA Sequence : | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRN DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRG SKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITG GLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPP VPNPDYEPIRKGQRDLYSGLNQRRI |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ] |
Official Symbol | CD3E |
Synonyms | CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain |
Gene ID | 916 |
mRNA Refseq | NM_000733 |
Protein Refseq | NP_000724 |
MIM | 186830 |
UniProt ID | P07766 |
◆ Recombinant Proteins | ||
CD3E-139C | Recombinant Cynomolgus monkey CD3E Protein, His-tagged | +Inquiry |
CD3E-10952H | Recombinant Human CD3E, GST-tagged | +Inquiry |
CD3E-047H | Recombinant Human CD3E Protein, Asp23-Thr48, C-hFc-Avi tagged, Biotinylated | +Inquiry |
CD3E&CD3G-222C | Recombinant Cynomolgus CD3E & CD3G protein, Fc-tagged | +Inquiry |
CD3E-141H | Recombinant Human CD3E Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *