Recombinant Full Length Human CD3E Protein

Cat.No. : CD3E-62HF
Product Overview : Recombinant full length mature Human CD3 epsilon with N terminal proprietary tag; predicted MWt 46.46 kDa inclusive of tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 185 amino acids
Description : The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Form : Liquid
Molecular Mass : 46.460kDa inclusive of tags
AA Sequence : DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRN DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRG SKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITG GLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPP VPNPDYEPIRKGQRDLYSGLNQRRI
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ]
Official Symbol CD3E
Synonyms CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain
Gene ID 916
mRNA Refseq NM_000733
Protein Refseq NP_000724
MIM 186830
UniProt ID P07766

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD3E Products

Required fields are marked with *

My Review for All CD3E Products

Required fields are marked with *

0
cart-icon
0
compare icon