Recombinant Full Length Human CD48 Protein
Cat.No. : | CD48-63HF |
Product Overview : | Recombinant full length Human CD48 with N terminal proprietary tag, 44.33kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 169 amino acids |
Description : | BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48. |
Form : | Liquid |
Molecular Mass : | 44.330kDa inclusive of tags |
AA Sequence : | MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSN VTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESK FKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE WKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGE EERKTSGQV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CD48 CD48 molecule [ Homo sapiens ] |
Official Symbol | CD48 |
Synonyms | CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2 |
Gene ID | 962 |
mRNA Refseq | NM_001778 |
Protein Refseq | NP_001769 |
MIM | 109530 |
UniProt ID | P09326 |
◆ Recombinant Proteins | ||
Cd48-8762R | Recombinant Rat Cd48 protein(Met1-Arg216), hFc-tagged | +Inquiry |
CD48-2638H | Active Recombinant Human CD48 protein, hFc&His-tagged | +Inquiry |
CD48-654HAF555 | Recombinant Human CD48 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Cd48-8762RAF488 | Recombinant Rat Cd48 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD48-867MF | Active Recombinant Mouse CD48 Protein, His-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD48-2468MCL | Recombinant Mouse CD48 cell lysate | +Inquiry |
CD48-3044HCL | Recombinant Human CD48 cell lysate | +Inquiry |
CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD48 Products
Required fields are marked with *
My Review for All CD48 Products
Required fields are marked with *