Recombinant Full Length Human CD48 Protein

• Cat.No.: CD48-63HF
• Product Overview: Recombinant full length Human CD48 with N terminal proprietary tag, 44.33kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 169 amino acids
• Description: BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48.
• Form: Liquid
• Molecular Mass: 44.330kDa inclusive of tags
• AA Sequence: MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSN VTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESK FKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE WKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGE EERKTSGQV
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CD48 CD48 molecule [ Homo sapiens ]
• Official Symbol: CD48
• Synonyms: CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2
• Gene ID: 962
• mRNA Refseq: NM_001778
• Protein Refseq: NP_001769
• MIM: 109530
• UniProt ID: P09326