Recombinant Full Length Human CD83 Protein
Cat.No. : | CD83-3077HF |
Product Overview : | Human CD83 full-length ORF (AAH30830.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 370 amino acids |
Description : | The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Form : | Liquid |
Molecular Mass : | 23 kDa |
AA Sequence : | MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV |
Applications : | Antibody Production Functional Study Compound Screening |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CD83 CD83 molecule [ Homo sapiens ] |
Official Symbol | CD83 |
Synonyms | CD83; CD83 molecule; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily), CD83 molecule; CD83 antigen; BL11; HB15; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); |
Gene ID | 9308 |
mRNA Refseq | NM_001040280 |
Protein Refseq | NP_001035370 |
MIM | 604534 |
UniProt ID | Q01151 |
◆ Recombinant Proteins | ||
CD83-3106H | Recombinant Human CD83 Protein, MYC/DDK-tagged | +Inquiry |
Cd83-625M | Active Recombinant Mouse Cd83 Protein, Fc Chimera | +Inquiry |
CD83-577R | Recombinant Rhesus Macaque CD83 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD83-0868H | Recombinant Human CD83 Protein | +Inquiry |
Cd83-6899M | Recombinant Mouse Cd83 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD83-1130CCL | Recombinant Cynomolgus CD83 cell lysate | +Inquiry |
CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
CD83-1845MCL | Recombinant Mouse CD83 cell lysate | +Inquiry |
CD83-1432RCL | Recombinant Rat CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD83 Products
Required fields are marked with *
My Review for All CD83 Products
Required fields are marked with *
0
Inquiry Basket