Recombinant Full Length Human CD83 Protein
| Cat.No. : | CD83-3077HF |
| Product Overview : | Human CD83 full-length ORF (AAH30830.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 370 amino acids |
| Description : | The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Form : | Liquid |
| Molecular Mass : | 23 kDa |
| AA Sequence : | MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV |
| Applications : | Antibody Production Functional Study Compound Screening |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CD83 CD83 molecule [ Homo sapiens ] |
| Official Symbol | CD83 |
| Synonyms | CD83; CD83 molecule; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily), CD83 molecule; CD83 antigen; BL11; HB15; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); |
| Gene ID | 9308 |
| mRNA Refseq | NM_001040280 |
| Protein Refseq | NP_001035370 |
| MIM | 604534 |
| UniProt ID | Q01151 |
| ◆ Recombinant Proteins | ||
| Cd83-701M | Recombinant Mouse Cd83 Protein, His-tagged | +Inquiry |
| CD83-751R | Recombinant Cynomolgus/Rhesus CD83 protein(Met1-Ala143), His-tagged | +Inquiry |
| Cd83-702R | Recombinant Rat Cd83 Protein, His-tagged | +Inquiry |
| CD83-5952H | Recombinant Human CD83 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CD83-577R | Recombinant Rhesus Macaque CD83 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD83-1845MCL | Recombinant Mouse CD83 cell lysate | +Inquiry |
| CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
| CD83-1432RCL | Recombinant Rat CD83 cell lysate | +Inquiry |
| CD83-1130CCL | Recombinant Cynomolgus CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD83 Products
Required fields are marked with *
My Review for All CD83 Products
Required fields are marked with *
