Recombinant Full Length Human CD84 Protein
| Cat.No. : | CD84-3082HF |
| Product Overview : | Human CD84 full-length ORF (NP_003865.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 776 amino acids |
| Description : | This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011] |
| Form : | Liquid |
| Molecular Mass : | 36.9 kDa |
| AA Sequence : | MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI |
| Applications : | Antibody Production Functional Study Compound Screening |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CD84 CD84 molecule [ Homo sapiens ] |
| Official Symbol | CD84 |
| Synonyms | CD84; CD84 molecule; CD84 antigen (leukocyte antigen), CD84 molecule; SLAM family member 5; hCD84; mCD84; SLAMF5; hly9-beta; leukocyte antigen CD84; cell surface antigen MAX.3; CD84 antigen (leukocyte antigen); leucocyte differentiation antigen CD84; leukocyte differentiation antigen CD84; signaling lymphocytic activation molecule 5; LY9B; DKFZp781E2378; |
| Gene ID | 8832 |
| mRNA Refseq | NM_001184879 |
| Protein Refseq | NP_001171808 |
| MIM | 604513 |
| UniProt ID | Q9UIB8 |
| ◆ Recombinant Proteins | ||
| CD84-58H | Recombinant Human CD84 protein, His-tagged | +Inquiry |
| CD84-5257H | Recombinant Human CD84 Protein (Met1-Gly225), C-His tagged | +Inquiry |
| CD84-3752H | Recombinant Human CD84 protein, rFc-tagged | +Inquiry |
| CD84-160H | Recombinant Human CD84 Protein, His-tagged | +Inquiry |
| Cd84-6900M | Active Recombinant Mouse Cd84 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD84-1129CCL | Recombinant Cynomolgus CD84 cell lysate | +Inquiry |
| CD84-3041HCL | Recombinant Human CD84 cell lysate | +Inquiry |
| CD84-1733MCL | Recombinant Mouse CD84 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD84 Products
Required fields are marked with *
My Review for All CD84 Products
Required fields are marked with *
