Recombinant Full Length Human CD84 Protein, GST-tagged

Cat.No. : CD84-3084HF
Product Overview : Human CD84 full-length ORF (NP_003865.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 328 amino acids
Description : This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]
Molecular Mass : 63.3 kDa
AA Sequence : MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD84 CD84 molecule [ Homo sapiens ]
Official Symbol CD84
Synonyms CD84; CD84 molecule; CD84 antigen (leukocyte antigen), CD84 molecule; SLAM family member 5; hCD84; mCD84; SLAMF5; hly9-beta; leukocyte antigen CD84; cell surface antigen MAX.3; CD84 antigen (leukocyte antigen); leucocyte differentiation antigen CD84; leukocyte differentiation antigen CD84; signaling lymphocytic activation molecule 5; LY9B; DKFZp781E2378;
Gene ID 8832
mRNA Refseq NM_001184879
Protein Refseq NP_001171808
MIM 604513
UniProt ID Q9UIB8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD84 Products

Required fields are marked with *

My Review for All CD84 Products

Required fields are marked with *

0
cart-icon
0
compare icon