Recombinant Full Length Human CD8A Protein, GST-tagged

Cat.No. : CD8A-3090HF
Product Overview : Human CD8A full-length ORF (AAH25715, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 235 amino acids
Description : The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Molecular Mass : 51.59 kDa
AA Sequence : MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD8A CD8a molecule [ Homo sapiens ]
Official Symbol CD8A
Synonyms CD8A; CD8a molecule; CD8, CD8 antigen, alpha polypeptide (p32), T cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2; CD8; MAL; p32; Leu2;
Gene ID 925
mRNA Refseq NM_001145873
Protein Refseq NP_001139345
MIM 186910
UniProt ID P01732

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD8A Products

Required fields are marked with *

My Review for All CD8A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon