Recombinant Full Length Human Cd9 Antigen(Cd9) Protein, His-Tagged
| Cat.No. : | RFL25776HF |
| Product Overview : | Recombinant Full Length Human CD9 antigen(CD9) Protein (P21926) (2-228aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-228) |
| Form : | Lyophilized powder |
| AA Sequence : | PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CD9 |
| Synonyms | CD9; MIC3; TSPAN29; GIG2; CD9 antigen; 5H9 antigen; Cell growth-inhibiting gene 2 protein; Leukocyte antigen MIC3; Motility-related protein; MRP-1; Tetraspanin-29; Tspan-29; p24; CD antigen CD9 |
| UniProt ID | P21926 |
| ◆ Recombinant Proteins | ||
| Cd9-6643M | Recombinant Mouse Cd9 protein, His&Myc-tagged | +Inquiry |
| Cd9-1333M | Recombinant Mouse Cd9 Full Length Transmembrane protein, His-tagged | +Inquiry |
| CD9-0882H | Recombinant Human CD9 Protein, GST-Tagged | +Inquiry |
| RFL10989SF | Recombinant Full Length Pig Cd9 Antigen(Cd9) Protein, His-Tagged | +Inquiry |
| RFL13226FF | Recombinant Full Length Cat Cd9 Antigen(Cd9) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD9-2110HCL | Recombinant Human CD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD9 Products
Required fields are marked with *
My Review for All CD9 Products
Required fields are marked with *
