Recombinant Human CD9 Protein, His-tagged

Cat.No. : CD9-1H
Product Overview : Recombinant human CD9 (112-195aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability September 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 112-195aa
Description : This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.
Form : Liquid
Molecular Mass : 10.7kDa (93aa)
AA Sequence : SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Endotoxin : < 1.0 EU/μg of the protein by the LAL method.
Purity : >90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol.
Gene Name CD9 CD9 molecule [ Homo sapiens (human) ]
Official Symbol CD9
Synonyms CD9; CD9 molecule; CD9 CD9 molecule; CD9 antigen; 5H9 antigen; BA-2/p24 antigen; CD9 antigen (p24); antigen CD9; cell growth-inhibiting gene 2 protein; leukocyte antigen MIC3; motility related protein-1; tetraspanin-29; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
Gene ID 928
mRNA Refseq NM_001769
Protein Refseq NP_001760
MIM 143030
UniProt ID P21926

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD9 Products

Required fields are marked with *

My Review for All CD9 Products

Required fields are marked with *

0
cart-icon
0
compare icon