Recombinant Human CD9 Protein, His-tagged

• Cat.No.: CD9-1H
• Product Overview: Recombinant human CD9 (112-195aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 112-195aa
• Description: This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.
• Form: Liquid
• Molecular Mass: 10.7kDa (93aa)
• AA Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
• Endotoxin: < 1.0 EU/μg of the protein by the LAL method.
• Purity: >90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol.

Gene Information

• Gene Name: CD9 CD9 molecule [ Homo sapiens (human) ]
• Official Symbol: CD9
• Synonyms: CD9; CD9 molecule; CD9 CD9 molecule; CD9 antigen; 5H9 antigen; BA-2/p24 antigen; CD9 antigen (p24); antigen CD9; cell growth-inhibiting gene 2 protein; leukocyte antigen MIC3; motility related protein-1; tetraspanin-29; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
• Gene ID: 928
• mRNA Refseq: NM_001769
• Protein Refseq: NP_001760
• MIM: 143030
• UniProt ID: P21926