Recombinant Full Length Human CDC16 Protein, GST-tagged
Cat.No. : | CDC16-3131HF |
Product Overview : | Human CDC16 full-length ORF (AAH17244, 1 a.a. - 620 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 620 amino acids |
Description : | The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 93.83 kDa |
AA Sequence : | MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC16 cell division cycle 16 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC16 |
Synonyms | CDC16; cell division cycle 16 homolog (S. cerevisiae); CDC16 (cell division cycle 16, S. cerevisiae, homolog), CDC16 cell division cycle 16 homolog (S. cerevisiae); cell division cycle protein 16 homolog; ANAPC6; anaphase promoting complex; subunit 6; APC6; CUT9; CDC16Hs; cyclosome subunit 6; anaphase-promoting complex subunit 6; anaphase-promoting complex, subunit 6; |
Gene ID | 8881 |
mRNA Refseq | NM_001078645 |
Protein Refseq | NP_001072113 |
MIM | 603461 |
UniProt ID | Q13042 |
◆ Recombinant Proteins | ||
CDC16-3535H | Recombinant Human CDC16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDC16-583R | Recombinant Rhesus Macaque CDC16 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC16-3514Z | Recombinant Zebrafish CDC16 | +Inquiry |
CDC16-1270H | Recombinant Human CDC16 protein, His & T7-tagged | +Inquiry |
Cdc16-2072M | Recombinant Mouse Cdc16 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC16-7669HCL | Recombinant Human CDC16 293 Cell Lysate | +Inquiry |
CDC16-7670HCL | Recombinant Human CDC16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC16 Products
Required fields are marked with *
My Review for All CDC16 Products
Required fields are marked with *
0
Inquiry Basket