Recombinant Full Length Human CDC20 Protein, C-Flag-tagged
Cat.No. : | CDC20-1042HFL |
Product Overview : | Recombinant Full Length Human CDC20 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.5 kDa |
AA Sequence : | MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTT PSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNA PEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWS ASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYI LSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQT FTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAK SSLIHQGIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cell cycle, Oocyte meiosis, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | CDC20 cell division cycle 20 [ Homo sapiens (human) ] |
Official Symbol | CDC20 |
Synonyms | CDC20A; p55CDC; bA276H19.3 |
Gene ID | 991 |
mRNA Refseq | NM_001255.3 |
Protein Refseq | NP_001246.2 |
MIM | 603618 |
UniProt ID | Q12834 |
◆ Recombinant Proteins | ||
CDC20-001H | Recombinant Human CDC20 Protein, MYC/DDK-tagged | +Inquiry |
CDC20-928R | Recombinant Rat CDC20 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC20-27897TH | Recombinant Human CDC20 | +Inquiry |
CDC20-5841H | Recombinant Human CDC20 protein, His&Myc-tagged | +Inquiry |
CDC20-553H | Recombinant Human CDC20 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC20-7668HCL | Recombinant Human CDC20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC20 Products
Required fields are marked with *
My Review for All CDC20 Products
Required fields are marked with *
0
Inquiry Basket