Recombinant Full Length Human CDC40 Protein, GST-tagged
| Cat.No. : | CDC40-3075HF |
| Product Overview : | Human CDC40 full-length ORF (NP_056975.1, 1 a.a. - 579 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 579 amino acids |
| Description : | Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 91.9 kDa |
| AA Sequence : | MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDC40 cell division cycle 40 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | CDC40 |
| Synonyms | EHB3; PRP17; PRPF17 |
| Gene ID | 51362 |
| mRNA Refseq | NM_015891 |
| Protein Refseq | NP_056975 |
| MIM | 605585 |
| UniProt ID | O60508 |
| ◆ Recombinant Proteins | ||
| CDC40-3138M | Recombinant Mouse CDC40 Protein | +Inquiry |
| CDC40-1992Z | Recombinant Zebrafish CDC40 | +Inquiry |
| CDC40-588R | Recombinant Rhesus Macaque CDC40 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDC40-1549C | Recombinant Chicken CDC40 | +Inquiry |
| CDC40-3075HF | Recombinant Full Length Human CDC40 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDC40-7658HCL | Recombinant Human CDC40 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC40 Products
Required fields are marked with *
My Review for All CDC40 Products
Required fields are marked with *
