Recombinant Full Length Human CDC42 Protein, GST-tagged
Cat.No. : | CDC42-3101HF |
Product Overview : | Human CDC42 full-length ORF (AAH03682.1, 1 a.a. - 191 a.a.) recombinant protein with GST-pstS1 tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 191 amino acids |
Description : | The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20. [provided by RefSeq, Apr 2013] |
Molecular Mass : | 49.06 kDa |
AA Sequence : | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC42 cell division cycle 42 (GTP binding protein, 25kDa) [ Homo sapiens ] |
Official Symbol | CDC42 |
Synonyms | CDC42; cell division cycle 42 (GTP binding protein, 25kDa); cell division cycle 42 (GTP binding protein, 25kD); cell division control protein 42 homolog; CDC42Hs; G25K; G25K GTP-binding protein; GTP-binding protein, 25kD; growth-regulating protein; small GTP binding protein CDC42; dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)); dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD)); |
Gene ID | 998 |
mRNA Refseq | NM_001039802 |
Protein Refseq | NP_001034891 |
MIM | 116952 |
UniProt ID | P60953 |
◆ Recombinant Proteins | ||
CDC42-2636H | Active Recombinant Human CDC42(T17N) protein, GST-tagged | +Inquiry |
CDC42-1712H | Recombinant Human CDC42 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDC42-1806H | Recombinant Human CDC42 protein(Met1-Cys188), GST-tagged | +Inquiry |
CDC42-26651TH | Recombinant Human CDC42, T7 -tagged | +Inquiry |
CDC42-162H | Recombinant Full Length Human cell division cycle 42 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC42-7655HCL | Recombinant Human CDC42 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC42 Products
Required fields are marked with *
My Review for All CDC42 Products
Required fields are marked with *