Recombinant Full Length Human CDC42 Protein, GST-tagged

Cat.No. : CDC42-3101HF
Product Overview : Human CDC42 full-length ORF (AAH03682.1, 1 a.a. - 191 a.a.) recombinant protein with GST-pstS1 tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 191 amino acids
Description : The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20. [provided by RefSeq, Apr 2013]
Molecular Mass : 49.06 kDa
AA Sequence : MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDC42 cell division cycle 42 (GTP binding protein, 25kDa) [ Homo sapiens ]
Official Symbol CDC42
Synonyms CDC42; cell division cycle 42 (GTP binding protein, 25kDa); cell division cycle 42 (GTP binding protein, 25kD); cell division control protein 42 homolog; CDC42Hs; G25K; G25K GTP-binding protein; GTP-binding protein, 25kD; growth-regulating protein; small GTP binding protein CDC42; dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)); dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD));
Gene ID 998
mRNA Refseq NM_001039802
Protein Refseq NP_001034891
MIM 116952
UniProt ID P60953

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC42 Products

Required fields are marked with *

My Review for All CDC42 Products

Required fields are marked with *

0
cart-icon