Recombinant Full Length Human CDC42EP2 Protein, GST-tagged

• Cat.No.: CDC42EP2-3103HF
• Product Overview: Human CDC42EP2 full-length ORF (NP_006770.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 210 amino acids
• Description: CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of CDC42. Coexpression of this protein with CDC42 suggested a role of this protein in actin filament assembly and cell shape control. [provided by RefSeq, Aug 2011]
• Molecular Mass: 48.9 kDa
• AA Sequence: MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDC42EP2 CDC42 effector protein (Rho GTPase binding) 2 [ Homo sapiens ]
• Official Symbol: CDC42EP2
• Synonyms: CDC42EP2; CDC42 effector protein (Rho GTPase binding) 2; cdc42 effector protein 2; BORG1; CEP2; CRIB containing BOGR1 protein; binder of Rho GTPases 1; CRIB-containing BOGR1 protein
• Gene ID: 10435
• mRNA Refseq: NM_006779
• Protein Refseq: NP_006770
• MIM: 606132
• UniProt ID: O14613