Recombinant Human CDC42EP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CDC42EP2-1650H |
| Product Overview : | CDC42EP2 MS Standard C13 and N15-labeled recombinant protein (NP_006770) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of CDC42. Coexpression of this protein with CDC42 suggested a role of this protein in actin filament assembly and cell shape control. |
| Molecular Mass : | 22.5 kDa |
| AA Sequence : | MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CDC42EP2 CDC42 effector protein 2 [ Homo sapiens (human) ] |
| Official Symbol | CDC42EP2 |
| Synonyms | CDC42EP2; CDC42 effector protein (Rho GTPase binding) 2; cdc42 effector protein 2; BORG1; CEP2; CRIB containing BOGR1 protein; binder of Rho GTPases 1; CRIB-containing BOGR1 protein; |
| Gene ID | 10435 |
| mRNA Refseq | NM_006779 |
| Protein Refseq | NP_006770 |
| MIM | 606132 |
| UniProt ID | O14613 |
| ◆ Recombinant Proteins | ||
| Cdc42ep2-254M | Recombinant Mouse Cdc42ep2 Protein, MYC/DDK-tagged | +Inquiry |
| CDC42EP2-764R | Recombinant Rhesus monkey CDC42EP2 Protein, His-tagged | +Inquiry |
| CDC42EP2-590R | Recombinant Rhesus Macaque CDC42EP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDC42EP2-1650H | Recombinant Human CDC42EP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CDC42EP2-3144M | Recombinant Mouse CDC42EP2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDC42EP2-7653HCL | Recombinant Human CDC42EP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC42EP2 Products
Required fields are marked with *
My Review for All CDC42EP2 Products
Required fields are marked with *
