Recombinant Full Length Human CDK7 Protein, GST-tagged
Cat.No. : | CDK7-3164HF |
Product Overview : | Human CDK7 full-length ORF (AAH00834.1, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 346 amino acids |
Description : | The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 63.58 kDa |
AA Sequence : | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDK7 cyclin-dependent kinase 7 [ Homo sapiens ] |
Official Symbol | CDK7 |
Synonyms | CDK7; cyclin-dependent kinase 7; cyclin dependent kinase 7 (homolog of Xenopus MO15 cdk activating kinase), cyclin dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk activating kinase); CAK; CAK1; CDKN7; MO15; STK1; p39 Mo15; protein kinase; 39 KDa protein kinase; kinase subunit of CAK; CDK-activating kinase 1; serine/threonine kinase stk1; cell division protein kinase 7; serine/threonine protein kinase 1; serine/threonine-protein kinase 1; serine/threonine protein kinase MO15; homolog of Xenopus MO15 Cdk-activating kinase; TFIIH basal transcription factor complex kinase subunit; cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase); HCAK; p39MO15; |
Gene ID | 1022 |
mRNA Refseq | NM_001799 |
Protein Refseq | NP_001790 |
MIM | 601955 |
UniProt ID | P50613 |
◆ Recombinant Proteins | ||
CDK7-1033H | Recombinant Human CDK7 Protein, GST-Tagged | +Inquiry |
CDK7-1530M | Recombinant Mouse CDK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK7-939HFL | Recombinant Full Length Human CDK7 Protein, C-Flag-tagged | +Inquiry |
CDK7-12210Z | Recombinant Zebrafish CDK7 | +Inquiry |
CDK7-1035H | Active Recombinant Human CDK7 Protein, GST-His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK7-7621HCL | Recombinant Human CDK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK7 Products
Required fields are marked with *
My Review for All CDK7 Products
Required fields are marked with *
0
Inquiry Basket