Recombinant Full Length Human CDK9 Protein, GST-tagged
| Cat.No. : | CDK9-3165HF |
| Product Overview : | Human CDK9 full-length ORF (AAH01968, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 372 amino acids |
| Description : | The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 66.66 kDa |
| AA Sequence : | MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDK9 cyclin-dependent kinase 9 [ Homo sapiens ] |
| Official Symbol | CDK9 |
| Synonyms | CDK9; cyclin-dependent kinase 9; CDC2L4, cyclin dependent kinase 9 (CDC2 related kinase); C 2k; PITALRE; TAK; CDC2-related kinase; cell division protein kinase 9; serine/threonine protein kinase PITALRE; serine/threonine-protein kinase PITALRE; cell division cycle 2-like protein kinase 4; tat-associated kinase complex catalytic subunit; C-2k; CTK1; CDC2L4; |
| Gene ID | 1025 |
| mRNA Refseq | NM_001261 |
| Protein Refseq | NP_001252 |
| MIM | 603251 |
| UniProt ID | P50750 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK9 Products
Required fields are marked with *
My Review for All CDK9 Products
Required fields are marked with *
