Recombinant Full Length Human CDKN2A Protein, GST-tagged
| Cat.No. : | CDKN2A-3227HF |
| Product Overview : | Human CDKN2A full-length ORF (AAH15960, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 105 amino acids |
| Description : | This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene. [provided by RefSeq, Sep 2012] |
| Molecular Mass : | 37.29 kDa |
| AA Sequence : | MMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDKN2A cyclin-dependent kinase inhibitor 2A [ Homo sapiens ] |
| Official Symbol | CDKN2A |
| Synonyms | CDKN2A; cyclin-dependent kinase inhibitor 2A; CDKN2, cyclin dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4), MLM; ARF; CDK4I; CMM2; INK4; INK4a; MTS1; p14; p16; p16INK4a; p19; p19Arf; CDK4 inhibitor p16-INK4; multiple tumor suppressor 1; cell cycle negative regulator beta; cyclin-dependent kinase 4 inhibitor A; cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4); MLM; P14; P16; P19; TP16; CDKN2; INK4A; MTS-1; P14ARF; P19ARF; P16INK4; P16INK4A; P16-INK4A; |
| Gene ID | 1029 |
| mRNA Refseq | NM_000077 |
| Protein Refseq | NP_000068 |
| MIM | 600160 |
| UniProt ID | P42771 |
| ◆ Recombinant Proteins | ||
| CDKN2A-10H | Recombinant Human CDKN2A protein | +Inquiry |
| CDKN2A-7704H | Recombinant Human CDKN2A protein, His & T7-tagged | +Inquiry |
| CDKN2A-3223M | Recombinant Mouse CDKN2A Protein | +Inquiry |
| CDKN2A-4499H | Recombinant Human CDKN2A protein, His-tagged | +Inquiry |
| CDKN2A-6004C | Recombinant Chicken CDKN2A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDKN2A-7616HCL | Recombinant Human CDKN2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2A Products
Required fields are marked with *
My Review for All CDKN2A Products
Required fields are marked with *




