Recombinant Full Length Human CDKN3 Protein, GST-tagged
Cat.No. : | CDKN3-3235HF |
Product Overview : | Human CDKN3 full-length ORF (AAH64965, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 172 amino acids |
Description : | The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008] |
Molecular Mass : | 44.44 kDa |
AA Sequence : | MKPPSSIQTSCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDKN3 cyclin-dependent kinase inhibitor 3 [ Homo sapiens ] |
Official Symbol | CDKN3 |
Synonyms | CDKN3; cyclin-dependent kinase inhibitor 3; CDI1; CDK2 associated dual specificity phosphatase; cyclin dependent kinase inhibitor; KAP; kinase associated phosphatase; kinase-associated phosphatase; Cdk-associated protein phosphatase; cyclin-dependent kinase interactor 1; CDK2-associated dual specificity phosphatase; CDK2-associated dual-specificity phosphatase; cyclin-dependent kinase interacting protein 2; cyclin-dependent kinase-interacting protein 2; CIP2; KAP1; FLJ25787; MGC70625; |
Gene ID | 1033 |
mRNA Refseq | NM_001130851 |
Protein Refseq | NP_001124323 |
MIM | 123832 |
UniProt ID | Q16667 |
◆ Recombinant Proteins | ||
CDKN3-26470TH | Recombinant Human CDKN3, His-tagged | +Inquiry |
CDKN3-798R | Recombinant Rhesus monkey CDKN3 Protein, His-tagged | +Inquiry |
CDKN3-26472TH | Recombinant Human CDKN3 | +Inquiry |
CDKN3-3229M | Recombinant Mouse CDKN3 Protein | +Inquiry |
CDKN3-6980H | Recombinant Human CDKN3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN3-7609HCL | Recombinant Human CDKN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN3 Products
Required fields are marked with *
My Review for All CDKN3 Products
Required fields are marked with *