Recombinant Full Length Human CDO1 Protein, GST-tagged
Cat.No. : | CDO1-3246HF |
Product Overview : | Human CDO1 full-length ORF (NP_001792.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 200 amino acids |
Description : | CDO1 (Cysteine Dioxygenase Type 1) is a Protein Coding gene. Diseases associated with CDO1 include Hepatoblastoma. Among its related pathways are Viral mRNA Translation and Sulfur amino acid metabolism. GO annotations related to this gene include iron ion binding and cysteamine dioxygenase activity. |
Molecular Mass : | 49.4 kDa |
AA Sequence : | MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDO1 cysteine dioxygenase, type I [ Homo sapiens ] |
Official Symbol | CDO1 |
Synonyms | CDO1; cysteine dioxygenase, type I; cysteine dioxygenase type 1; CDO; CDO-I; |
Gene ID | 1036 |
mRNA Refseq | NM_001801 |
Protein Refseq | NP_001792 |
MIM | 603943 |
UniProt ID | Q16878 |
◆ Recombinant Proteins | ||
CDO1-626R | Recombinant Rhesus Macaque CDO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDO1-3246HF | Recombinant Full Length Human CDO1 Protein, GST-tagged | +Inquiry |
CDO1-374H | Recombinant Human Cysteine Dioxygenase, Type I | +Inquiry |
CDO1-1317R | Recombinant Rat CDO1 Protein | +Inquiry |
CDO1-11004Z | Recombinant Zebrafish CDO1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDO1-7608HCL | Recombinant Human CDO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDO1 Products
Required fields are marked with *
My Review for All CDO1 Products
Required fields are marked with *
0
Inquiry Basket