Recombinant Human CDO1 protein, GST-tagged
Cat.No. : | CDO1-301509H |
Product Overview : | Recombinant Human CDO1 (1-200 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asn200 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CDO1 cysteine dioxygenase, type I [ Homo sapiens ] |
Official Symbol | CDO1 |
Synonyms | CDO1; cysteine dioxygenase, type I; cysteine dioxygenase type 1; CDO; CDO-I; |
Gene ID | 1036 |
mRNA Refseq | NM_001801 |
Protein Refseq | NP_001792 |
MIM | 603943 |
UniProt ID | Q16878 |
◆ Recombinant Proteins | ||
CDO1-3246HF | Recombinant Full Length Human CDO1 Protein, GST-tagged | +Inquiry |
Cdo1-873M | Recombinant Mouse Cdo1 Protein, MYC/DDK-tagged | +Inquiry |
CDO1-1250H | Recombinant Human Cysteine Dioxygenase, Type I, His-tagged | +Inquiry |
CDO1-1542M | Recombinant Mouse CDO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDO1-928H | Recombinant Human CDO1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDO1-7608HCL | Recombinant Human CDO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDO1 Products
Required fields are marked with *
My Review for All CDO1 Products
Required fields are marked with *