Recombinant Full Length Human CDRT4 Protein, GST-tagged
| Cat.No. : | CDRT4-3250HF | 
| Product Overview : | Human CDRT4 full-length ORF (BAC04263.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 152 amino acids | 
| Description : | CDRT4 (CMT1A Duplicated Region Transcript 4) is a Protein Coding gene. GO annotations related to this gene include DNA-directed 5-3 RNA polymerase activity. | 
| Molecular Mass : | 44 kDa | 
| AA Sequence : | MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSSGKAVFRDTLSESTLSMWGAYSVLAMAPTMIPEPTHLHADSRDCPTENYNKIIFARKPMMRMLPTVRY | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CDRT4 CMT1A duplicated region transcript 4 [ Homo sapiens ] | 
| Official Symbol | CDRT4 | 
| Synonyms | CDRT4; CMT1A duplicated region transcript 4; CMT1A duplicated region transcript 4 protein; FLJ36674; MGC33988; | 
| Gene ID | 284040 | 
| mRNA Refseq | NM_001204477 | 
| Protein Refseq | NP_001191406 | 
| UniProt ID | Q8N9R6 | 
| ◆ Recombinant Proteins | ||
| CDRT4-1075H | Recombinant Human CDRT4 Protein, GST-Tagged | +Inquiry | 
| CDRT4-1546M | Recombinant Mouse CDRT4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CDRT4-3236M | Recombinant Mouse CDRT4 Protein | +Inquiry | 
| Cdrt4-2096M | Recombinant Mouse Cdrt4 Protein, Myc/DDK-tagged | +Inquiry | 
| CDRT4-3250HF | Recombinant Full Length Human CDRT4 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CDRT4-7606HCL | Recombinant Human CDRT4 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDRT4 Products
Required fields are marked with *
My Review for All CDRT4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            