Recombinant Full Length Human CEBPA Protein, GST-tagged
Cat.No. : | CEBPA-3277HF |
Product Overview : | Human CEBPA full-length ORF (AAI60133.1, 1 a.a. - 358 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 358 amino acids |
Description : | This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons. [provided by RefSeq, Dec 2013] |
Molecular Mass : | 65.8 kDa |
AA Sequence : | MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEBPA CCAAT/enhancer binding protein (C/EBP), alpha [ Homo sapiens ] |
Official Symbol | CEBPA |
Synonyms | CEBPA; CCAAT/enhancer binding protein (C/EBP), alpha; CEBP; CCAAT/enhancer-binding protein alpha; C/EBP alpha; C/EBP-alpha; |
Gene ID | 1050 |
mRNA Refseq | NM_004364 |
Protein Refseq | NP_004355 |
MIM | 116897 |
UniProt ID | P49715 |
◆ Recombinant Proteins | ||
CEBPA-3259M | Recombinant Mouse CEBPA Protein | +Inquiry |
CEBPA-1586HFL | Recombinant Full Length Human CEBPA Protein, N-His-tagged | +Inquiry |
CEBPA-94H | Recombinant Human CCAAT/enhancer Binding Protein(C/EBP) α, His-tagged | +Inquiry |
CEBPA-170H | Recombinant Human CEBPA | +Inquiry |
CEBPA-153H | Recombinant Human CEBPA protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEBPA Products
Required fields are marked with *
My Review for All CEBPA Products
Required fields are marked with *
0
Inquiry Basket