| Species : | Human | 
                                
                                    | Source : | Mammalian Cells | 
                                
                                    | Tag : | Flag | 
                                
                                    | Description : | This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. | 
                                
                                    | Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
                                
                                    | Molecular Mass : | 35.9 kDa | 
                                
                                    | AA Sequence : | MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHE RAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYV SLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAY LGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRER NNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHCTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
                                
                                    | Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
                                
                                    | Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
                                
                                    | Storage : | Store at -80 centigrade. | 
                                
                                    | Concentration : | >50 ug/mL as determined by microplate BCA method. | 
                                
                                    | Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
                                
                                    | Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors | 
                                
                                    | Full Length : | Full L. |