Recombinant Full Length Human CEBPE Protein, GST-tagged
| Cat.No. : | CEBPE-3280HF |
| Product Overview : | Human CEBPE full-length ORF (AAH35797.2, 1 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 281 amino acids |
| Description : | The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 56.65 kDa |
| AA Sequence : | MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CEBPE CCAAT/enhancer binding protein (C/EBP), epsilon [ Homo sapiens ] |
| Official Symbol | CEBPE |
| Synonyms | CEBPE; CCAAT/enhancer binding protein (C/EBP), epsilon; CCAAT/enhancer-binding protein epsilon; CRP1; c/EBP epsilon; C/EBP-epsilon; |
| Gene ID | 1053 |
| mRNA Refseq | NM_001805 |
| Protein Refseq | NP_001796 |
| MIM | 600749 |
| UniProt ID | Q15744 |
| ◆ Recombinant Proteins | ||
| CEBPE-985R | Recombinant Rat CEBPE Protein, His (Fc)-Avi-tagged | +Inquiry |
| CEBPE-806R | Recombinant Rhesus monkey CEBPE Protein, His-tagged | +Inquiry |
| CEBPE-3262M | Recombinant Mouse CEBPE Protein | +Inquiry |
| CEBPE-1561M | Recombinant Mouse CEBPE Protein, His (Fc)-Avi-tagged | +Inquiry |
| CEBPE-1104H | Recombinant Human CEBPE Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CEBPE-7597HCL | Recombinant Human CEBPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEBPE Products
Required fields are marked with *
My Review for All CEBPE Products
Required fields are marked with *



