Recombinant Full Length Human CEBPE Protein, GST-tagged

Cat.No. : CEBPE-3280HF
Product Overview : Human CEBPE full-length ORF (AAH35797.2, 1 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 281 amino acids
Description : The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]
Molecular Mass : 56.65 kDa
AA Sequence : MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CEBPE CCAAT/enhancer binding protein (C/EBP), epsilon [ Homo sapiens ]
Official Symbol CEBPE
Synonyms CEBPE; CCAAT/enhancer binding protein (C/EBP), epsilon; CCAAT/enhancer-binding protein epsilon; CRP1; c/EBP epsilon; C/EBP-epsilon;
Gene ID 1053
mRNA Refseq NM_001805
Protein Refseq NP_001796
MIM 600749
UniProt ID Q15744

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEBPE Products

Required fields are marked with *

My Review for All CEBPE Products

Required fields are marked with *

0
cart-icon