Recombinant Human CEBPE Protein, GST-Tagged
Cat.No. : | CEBPE-1104H |
Product Overview : | Human CEBPE full-length ORF (AAH35797.2, 1 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 56.65 kDa |
AA Sequence : | MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEBPE CCAAT/enhancer binding protein (C/EBP), epsilon [ Homo sapiens ] |
Official Symbol | CEBPE |
Synonyms | CEBPE; CCAAT/enhancer binding protein (C/EBP), epsilon; CCAAT/enhancer-binding protein epsilon; CRP1; c/EBP epsilon; C/EBP-epsilon; |
Gene ID | 1053 |
mRNA Refseq | NM_001805 |
Protein Refseq | NP_001796 |
MIM | 600749 |
UniProt ID | Q15744 |
◆ Recombinant Proteins | ||
CEBPE-1104H | Recombinant Human CEBPE Protein, GST-Tagged | +Inquiry |
CEBPE-985R | Recombinant Rat CEBPE Protein, His (Fc)-Avi-tagged | +Inquiry |
CEBPE-839H | Recombinant Human CEBPE Protein, His-tagged | +Inquiry |
CEBPE-1561M | Recombinant Mouse CEBPE Protein, His (Fc)-Avi-tagged | +Inquiry |
CEBPE-1327R | Recombinant Rat CEBPE Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEBPE-7597HCL | Recombinant Human CEBPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEBPE Products
Required fields are marked with *
My Review for All CEBPE Products
Required fields are marked with *