Recombinant Full Length Human CELF1 Protein, C-Flag-tagged
Cat.No. : | CELF1-1436HFL |
Product Overview : | Recombinant Full Length Human CELF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.4 kDa |
AA Sequence : | MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA ASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNAL TTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTG STMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMP FGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | CELF1 CUGBP Elav-like family member 1 [ Homo sapiens (human) ] |
Official Symbol | CELF1 |
Synonyms | CUGBP; NAB50; NAPOR; CUG-BP; CUGBP1; hNab50; BRUNOL2; EDEN-BP |
Gene ID | 10658 |
mRNA Refseq | NM_006560.4 |
Protein Refseq | NP_006551.1 |
MIM | 601074 |
UniProt ID | Q92879 |
◆ Recombinant Proteins | ||
CELF1-1436HFL | Recombinant Full Length Human CELF1 Protein, C-Flag-tagged | +Inquiry |
CELF1-1244H | Recombinant Human CELF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CELF1-2391HF | Recombinant Full Length Human CELF1 Protein, GST-tagged | +Inquiry |
CELF1-705H | Recombinant Human CELF1 protein(T173E,S178D,S285D,S288D,S295D,S296D,S298D) | +Inquiry |
CELF1-6334H | Recombinant Human CELF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELF1-7590HCL | Recombinant Human CELF1 293 Cell Lysate | +Inquiry |
CELF1-7589HCL | Recombinant Human CELF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CELF1 Products
Required fields are marked with *
My Review for All CELF1 Products
Required fields are marked with *
0
Inquiry Basket