Recombinant Full Length Human CELF4 Protein, GST-tagged

Cat.No. : CELF4-3815HF
Product Overview : Human BRUNOL4 full-length ORF (1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 250 amino acids
Description : Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 53.6 kDa
AA Sequence : MNRPIQVKPADSESRGDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPVSAGPLGRGRGQRRAETPAPATPRRLSSLPKRQESMTLIPGLRQGRGSPGMLRNWPEVTQVENARGGVHTSFPWASADAASSKAPRGAGGVGAGQRHRQLRAEALEQVGLTRRPGRREPRPVWWSSSPTPTRSARCGECSRWLARWACSTPWPSLSGPTAPTLRQ
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CELF4 CUGBP, Elav-like family member 4 [ Homo sapiens ]
Official Symbol CELF4
Synonyms CELF4; CUGBP, Elav-like family member 4; Bruno (Drosophila) like 4, RNA binding protein , bruno like 4, RNA binding protein (Drosophila) , BRUNOL4; CUGBP Elav-like family member 4; CELF-4; bruno-like protein 4; RNA-binding protein BRUNOL4; RNA-binding protein BRUNOL-4; LYST-interacting protein LIP9; CUG-BP and ETR-3 like factor 4; CUG-BP- and ETR-3-like factor 4; bruno-like 4, RNA binding protein; Bruno -like 4, RNA binding protein; BRUNOL4; BRUNOL-4;
Gene ID 56853
mRNA Refseq NM_001025087
Protein Refseq NP_001020258
MIM 612679
UniProt ID Q9BZC1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CELF4 Products

Required fields are marked with *

My Review for All CELF4 Products

Required fields are marked with *

0
cart-icon