Recombinant Full Length Human CELF4 Protein, GST-tagged

• Cat.No.: CELF4-3815HF
• Product Overview: Human BRUNOL4 full-length ORF (1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 250 amino acids
• Description: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 53.6 kDa
• AA Sequence: MNRPIQVKPADSESRGDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPVSAGPLGRGRGQRRAETPAPATPRRLSSLPKRQESMTLIPGLRQGRGSPGMLRNWPEVTQVENARGGVHTSFPWASADAASSKAPRGAGGVGAGQRHRQLRAEALEQVGLTRRPGRREPRPVWWSSSPTPTRSARCGECSRWLARWACSTPWPSLSGPTAPTLRQ
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CELF4 CUGBP, Elav-like family member 4 [ Homo sapiens ]
• Official Symbol: CELF4
• Synonyms: CELF4; CUGBP, Elav-like family member 4; Bruno (Drosophila) like 4, RNA binding protein , bruno like 4, RNA binding protein (Drosophila) , BRUNOL4; CUGBP Elav-like family member 4; CELF-4; bruno-like protein 4; RNA-binding protein BRUNOL4; RNA-binding protein BRUNOL-4; LYST-interacting protein LIP9; CUG-BP and ETR-3 like factor 4; CUG-BP- and ETR-3-like factor 4; bruno-like 4, RNA binding protein; Bruno -like 4, RNA binding protein; BRUNOL4; BRUNOL-4
• Gene ID: 56853
• mRNA Refseq: NM_001025087
• Protein Refseq: NP_001020258
• MIM: 612679
• UniProt ID: Q9BZC1