Recombinant Full Length Human CEMP1 Protein, GST-tagged

• Cat.No.: CEMP1-6879HF
• Product Overview: Recombinant full-length Human CEMP1 (1 a.a. - 247 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 247 amino acids
• Description: Enables hydroxyapatite binding activity. Involved in several processes, including biomineral tissue development; cell population proliferation; and odontogenesis. Located in cytoplasm and nucleoplasm.
• Molecular Mass: 53.57 kDa
• AA Sequence: MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEV RIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENS GRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTAR VCHMGVCQGQGDTEDGRMTLMG
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEMP1 cementum protein 1 [ Homo sapiens (human) ]
• Official Symbol: CEMP1
• Synonyms: CEMP1; CP23; CP-23; cementum protein 1; cementoblastoma-derived protein 1; cementum protein 23; cementum protein-23
• Gene ID: 752014
• mRNA Refseq: NM_001048212
• Protein Refseq: NP_001041677
• MIM: 611113
• UniProt ID: Q6PRD7