Recombinant Full Length Human CEMP1 Protein, GST-tagged

Cat.No. : CEMP1-6879HF
Product Overview : Recombinant full-length Human CEMP1 (1 a.a. - 247 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 247 amino acids
Description : Enables hydroxyapatite binding activity. Involved in several processes, including biomineral tissue development; cell population proliferation; and odontogenesis. Located in cytoplasm and nucleoplasm.
Molecular Mass : 53.57 kDa
AA Sequence : MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEV RIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENS GRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTAR VCHMGVCQGQGDTEDGRMTLMG
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CEMP1 cementum protein 1 [ Homo sapiens (human) ]
Official Symbol CEMP1
Synonyms CEMP1; CP23; CP-23; cementum protein 1; cementoblastoma-derived protein 1; cementum protein 23; cementum protein-23
Gene ID 752014
mRNA Refseq NM_001048212
Protein Refseq NP_001041677
MIM 611113
UniProt ID Q6PRD7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEMP1 Products

Required fields are marked with *

My Review for All CEMP1 Products

Required fields are marked with *

0
cart-icon