Recombinant Full Length Human CEMP1 Protein, GST-tagged
Cat.No. : | CEMP1-6879HF |
Product Overview : | Recombinant full-length Human CEMP1 (1 a.a. - 247 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 247 amino acids |
Description : | Enables hydroxyapatite binding activity. Involved in several processes, including biomineral tissue development; cell population proliferation; and odontogenesis. Located in cytoplasm and nucleoplasm. |
Molecular Mass : | 53.57 kDa |
AA Sequence : | MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEV RIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENS GRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTAR VCHMGVCQGQGDTEDGRMTLMG |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEMP1 cementum protein 1 [ Homo sapiens (human) ] |
Official Symbol | CEMP1 |
Synonyms | CEMP1; CP23; CP-23; cementum protein 1; cementoblastoma-derived protein 1; cementum protein 23; cementum protein-23 |
Gene ID | 752014 |
mRNA Refseq | NM_001048212 |
Protein Refseq | NP_001041677 |
MIM | 611113 |
UniProt ID | Q6PRD7 |
◆ Recombinant Proteins | ||
CEMP1-18H | Recombinant Human CEMP1, GST-tagged | +Inquiry |
CEMP1-1682H | Recombinant Human CEMP1 Protein (1-247 aa), His-tagged | +Inquiry |
CEMP1-1683H | Recombinant Human CEMP1 protein, His-tagged | +Inquiry |
CEMP1-6879HF | Recombinant Full Length Human CEMP1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEMP1 Products
Required fields are marked with *
My Review for All CEMP1 Products
Required fields are marked with *