Recombinant Full Length Human CENPA Protein, C-Flag-tagged
Cat.No. : | CENPA-572HFL |
Product Overview : | Recombinant Full Length Human CENPA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 15.8 kDa |
AA Sequence : | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL AREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CENPA centromere protein A [ Homo sapiens (human) ] |
Official Symbol | CENPA |
Synonyms | CenH3; CENP-A |
Gene ID | 1058 |
mRNA Refseq | NM_001809.4 |
Protein Refseq | NP_001800.1 |
MIM | 117139 |
UniProt ID | P49450 |
◆ Recombinant Proteins | ||
CENPA-27391TH | Recombinant Human CENPA, His-tagged | +Inquiry |
CENPA-7573Z | Recombinant Zebrafish CENPA | +Inquiry |
CENPA-6623H | Recombinant Human CENPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CENPA-1575M | Recombinant Mouse CENPA Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPA-301526H | Recombinant Human CENPA protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPA-7586HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
CENPA-7587HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CENPA Products
Required fields are marked with *
My Review for All CENPA Products
Required fields are marked with *
0
Inquiry Basket