Recombinant Full Length Human CENPH Protein, GST-tagged
Cat.No. : | CENPH-3320HF |
Product Overview : | Human CENPH full-length ORF (AAH12024, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 247 amino acids |
Description : | Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 52.91 kDa |
AA Sequence : | MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CENPH centromere protein H [ Homo sapiens ] |
Official Symbol | CENPH |
Synonyms | CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1; CENP-H; kinetochore protein CENP-H; interphase centromere complex protein 35; |
Gene ID | 64946 |
mRNA Refseq | NM_022909 |
Protein Refseq | NP_075060 |
MIM | 605607 |
UniProt ID | Q9H3R5 |
◆ Recombinant Proteins | ||
CENPH-6179C | Recombinant Chicken CENPH | +Inquiry |
CENPH-3285M | Recombinant Mouse CENPH Protein | +Inquiry |
CENPH-1116H | Recombinant Human CENPH Protein, GST-Tagged | +Inquiry |
CENPH-2687H | Recombinant Human CENPH protein, GST-tagged | +Inquiry |
Cenph-2104M | Recombinant Mouse Cenph Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPH-7584HCL | Recombinant Human CENPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPH Products
Required fields are marked with *
My Review for All CENPH Products
Required fields are marked with *