Recombinant Full Length Human CENPH Protein, GST-tagged

Cat.No. : CENPH-3320HF
Product Overview : Human CENPH full-length ORF (AAH12024, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 247 amino acids
Description : Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. [provided by RefSeq, Jul 2008]
Molecular Mass : 52.91 kDa
AA Sequence : MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CENPH centromere protein H [ Homo sapiens ]
Official Symbol CENPH
Synonyms CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1; CENP-H; kinetochore protein CENP-H; interphase centromere complex protein 35;
Gene ID 64946
mRNA Refseq NM_022909
Protein Refseq NP_075060
MIM 605607
UniProt ID Q9H3R5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CENPH Products

Required fields are marked with *

My Review for All CENPH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon