Recombinant Human CENPH protein, GST-tagged
| Cat.No. : | CENPH-2687H | 
| Product Overview : | Recombinant Human CENPH protein(Q9H3R5)(1-247aa), fused to N-terminal GST tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 1-247aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 55.5 kDa | 
| AA Sequence : | MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | CENPH centromere protein H [ Homo sapiens ] | 
| Official Symbol | CENPH | 
| Synonyms | CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1; CENP-H; kinetochore protein CENP-H; interphase centromere complex protein 35; | 
| Gene ID | 64946 | 
| mRNA Refseq | NM_022909 | 
| Protein Refseq | NP_075060 | 
| MIM | 605607 | 
| UniProt ID | Q9H3R5 | 
| ◆ Recombinant Proteins | ||
| CENPH-1578M | Recombinant Mouse CENPH Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CENPH-2687H | Recombinant Human CENPH protein, GST-tagged | +Inquiry | 
| CENPH-325H | Recombinant Human CENPH Protein, His-tagged | +Inquiry | 
| CENPH-1116H | Recombinant Human CENPH Protein, GST-Tagged | +Inquiry | 
| Cenph-2104M | Recombinant Mouse Cenph Protein, Myc/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CENPH-7584HCL | Recombinant Human CENPH 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPH Products
Required fields are marked with *
My Review for All CENPH Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            