Recombinant Human CENPH protein, GST-tagged
Cat.No. : | CENPH-2687H |
Product Overview : | Recombinant Human CENPH protein(Q9H3R5)(1-247aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-247aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CENPH centromere protein H [ Homo sapiens ] |
Official Symbol | CENPH |
Synonyms | CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1; CENP-H; kinetochore protein CENP-H; interphase centromere complex protein 35; |
Gene ID | 64946 |
mRNA Refseq | NM_022909 |
Protein Refseq | NP_075060 |
MIM | 605607 |
UniProt ID | Q9H3R5 |
◆ Recombinant Proteins | ||
CENPH-1578M | Recombinant Mouse CENPH Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPH-2687H | Recombinant Human CENPH protein, GST-tagged | +Inquiry |
CENPH-325H | Recombinant Human CENPH Protein, His-tagged | +Inquiry |
CENPH-1116H | Recombinant Human CENPH Protein, GST-Tagged | +Inquiry |
Cenph-2104M | Recombinant Mouse Cenph Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPH-7584HCL | Recombinant Human CENPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPH Products
Required fields are marked with *
My Review for All CENPH Products
Required fields are marked with *