Recombinant Full Length Human CENPV Protein, GST-tagged
Cat.No. : | CENPV-3147HF |
Product Overview : | Human CENPV full-length ORF (AAH52604.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 275 amino acids |
Description : | CENPV (Centromere Protein V) is a Protein Coding gene. Diseases associated with CENPV include Intracranial Primitive Neuroectodermal Tumor and Diffuse Glomerulonephritis. GO annotations related to this gene include carbon-sulfur lyase activity. An important paralog of this gene is CENPVL2. |
Molecular Mass : | 56.65 kDa |
AA Sequence : | MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQNRHFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CENPV centromere protein V [ Homo sapiens ] |
Official Symbol | CENPV |
Synonyms | CENPV; centromere protein V; proline rich 6, PRR6; CENP V; p30; proline rich 6; nuclear protein p30; proline-rich protein 6; PRR6; CENP-V; 3110013H01Rik; |
Gene ID | 201161 |
mRNA Refseq | NM_181716 |
Protein Refseq | NP_859067 |
MIM | 608139 |
UniProt ID | Q7Z7K6 |
◆ Recombinant Proteins | ||
CENPV-1128H | Recombinant Human CENPV Protein, GST-Tagged | +Inquiry |
CENPV-3147HF | Recombinant Full Length Human CENPV Protein, GST-tagged | +Inquiry |
CENPV-3296M | Recombinant Mouse CENPV Protein | +Inquiry |
CENPV-1585M | Recombinant Mouse CENPV Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPV-7574HCL | Recombinant Human CENPV 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPV Products
Required fields are marked with *
My Review for All CENPV Products
Required fields are marked with *