Recombinant Full Length Human Ceramide Synthase 3(Cers3) Protein, His-Tagged
Cat.No. : | RFL35697HF |
Product Overview : | Recombinant Full Length Human Ceramide synthase 3(CERS3) Protein (Q8IU89) (1-383aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-383) |
Form : | Lyophilized powder |
AA Sequence : | MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFV ASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSR RNQERPSRLKKFQEACWRFAFYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYW YYILEMSFYWSLLFRLGFDVKRKDFLAHIIHHLAAISLMSFSWCANYIRSGTLVMIVHDV ADIWLESAKMFSYAGWTQTCNTLFFIFSTIFFISRLIVFPFWILYCTLILPMYHLEPFFS YIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGK EMDCLKNGLRAERHLIPNGQHGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CERS3 |
Synonyms | CERS3; LASS3; Ceramide synthase 3; CerS3; Dihydroceramide synthase 3; LAG1 longevity assurance homolog 3; Sphingosine N-acyltransferase CERS3; Ultra-long-chain ceramide synthase CERS3; Very-long-chain ceramide synthase CERS3 |
UniProt ID | Q8IU89 |
◆ Recombinant Proteins | ||
CERS3-3202H | Recombinant Human CERS3 Protein, MYC/DDK-tagged | +Inquiry |
CERS3-1131H | Recombinant Human CERS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cers3-2122M | Recombinant Mouse Cers3 Protein, Myc/DDK-tagged | +Inquiry |
RFL35697HF | Recombinant Full Length Human Ceramide Synthase 3(Cers3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CERS3 Products
Required fields are marked with *
My Review for All CERS3 Products
Required fields are marked with *
0
Inquiry Basket