Recombinant Full Length Human Ceramide Synthase 5(Cers5) Protein, His-Tagged
Cat.No. : | RFL7254HF |
Product Overview : | Recombinant Full Length Human Ceramide synthase 5(CERS5) Protein (Q8N5B7) (1-392aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-392) |
Form : | Lyophilized powder |
AA Sequence : | MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFV RLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPF QPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVG TLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFES WEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEED VTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CERS5 |
Synonyms | CERS5; LASS5; Ceramide synthase 5; CerS5; LAG1 longevity assurance homolog 5; Sphingoid base N-palmitoyltransferase CERS5; Sphingosine N-acyltransferase CERS5 |
UniProt ID | Q8N5B7 |
◆ Recombinant Proteins | ||
RFL7254HF | Recombinant Full Length Human Ceramide Synthase 5(Cers5) Protein, His-Tagged | +Inquiry |
CERS5-10029Z | Recombinant Zebrafish CERS5 | +Inquiry |
CERS5-1400H | Recombinant Human CERS5 | +Inquiry |
RFL16061MF | Recombinant Full Length Mouse Ceramide Synthase 5(Cers5) Protein, His-Tagged | +Inquiry |
CERS5-2659H | Recombinant Human CERS5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CERS5 Products
Required fields are marked with *
My Review for All CERS5 Products
Required fields are marked with *
0
Inquiry Basket