Recombinant Full Length Human CFAP298 Protein, C-Flag-tagged
| Cat.No. : | CFAP298-1166HFL |
| Product Overview : | Recombinant Full Length Human CFAP298 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 33 kDa |
| AA Sequence : | MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQI EELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVK DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGK NEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFH GVKDIKWRPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | CFAP298 cilia and flagella associated protein 298 [ Homo sapiens (human) ] |
| Official Symbol | CFAP298 |
| Synonyms | Kur; FBB18; CILD26; DNAAF16; C21orf48; C21orf59 |
| Gene ID | 56683 |
| mRNA Refseq | NM_021254.4 |
| Protein Refseq | NP_067077.1 |
| MIM | 615494 |
| UniProt ID | P57076 |
| ◆ Recombinant Proteins | ||
| CFAP298-6356H | Recombinant Human CFAP298 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CFAP298-1166HFL | Recombinant Full Length Human CFAP298 Protein, C-Flag-tagged | +Inquiry |
| CFAP298-582H | Recombinant Human CFAP298 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cfap298-2127M | Recombinant Mouse Cfap298 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFAP298 Products
Required fields are marked with *
My Review for All CFAP298 Products
Required fields are marked with *
