Recombinant Full Length Human CFAP69 Protein, GST-tagged
| Cat.No. : | CFAP69-3867HF |
| Product Overview : | Human C7orf63 full-length ORF ( ENSP00000340357, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 229 amino acids |
| Description : | CFAP69 (Cilia And Flagella Associated Protein 69) is a Protein Coding gene. GO annotations related to this gene include binding. |
| Molecular Mass : | 52 kDa |
| AA Sequence : | MWTEEAGATAEAQESGIRNKSSSSSQIPVVGVVTEDDEAQDVFKPMDLNRVIKLLEETDKDGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRFIESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLENQLVEKLWVLKVLQHLSTSGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CFAP69 cilia and flagella associated protein 69 [ Homo sapiens (human) ] |
| Official Symbol | CFAP69 |
| Synonyms | C7orf63; CFAP69; cilia and flagella associated protein 69; FAP69; cilia- and flagella-associated protein 69 |
| Gene ID | 79846 |
| mRNA Refseq | NM_001039706 |
| Protein Refseq | NP_001034795 |
| MIM | 617949 |
| UniProt ID | A5D8W1 |
| ◆ Recombinant Proteins | ||
| CFAP69-5187H | Recombinant Human CFAP69 Protein, GST-tagged | +Inquiry |
| CFAP69-3867HF | Recombinant Full Length Human CFAP69 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFAP69 Products
Required fields are marked with *
My Review for All CFAP69 Products
Required fields are marked with *




