Recombinant Human CFAP69 Protein, GST-tagged

• Cat.No.: CFAP69-5187H
• Product Overview: Human C7orf63 full-length ORF ( ENSP00000340357, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CFAP69 (Cilia And Flagella Associated Protein 69) is a Protein Coding gene. GO annotations related to this gene include binding.
• Molecular Mass: 52 kDa
• AA Sequence: MWTEEAGATAEAQESGIRNKSSSSSQIPVVGVVTEDDEAQDVFKPMDLNRVIKLLEETDKDGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRFIESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLENQLVEKLWVLKVLQHLSTSGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CFAP69 cilia and flagella associated protein 69 [ Homo sapiens (human) ]
• Official Symbol: CFAP69
• Synonyms: C7orf63; CFAP69; cilia and flagella associated protein 69; FAP69; cilia- and flagella-associated protein 69
• Gene ID: 79846
• mRNA Refseq: NM_001039706
• Protein Refseq: NP_001034795
• UniProt ID: A5D8W1