Recombinant Full Length Human CFI Protein, C-Flag-tagged
Cat.No. : | CFI-1531HFL |
Product Overview : | Recombinant Full Length Human CFI Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uremic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immune deposits and age-related macular degeneration are other conditions associated with mutations of this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.4 kDa |
AA Sequence : | MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKN GTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFI CKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFA DVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNG EVDCITGEDEVGCAGFASVAQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGD LPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHEN YNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVK LISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYT KVANYFDWISYHVGRPFISQYNVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Secreted Protein |
Protein Pathways : | Complement and coagulation cascades |
Full Length : | Full L. |
Gene Name | CFI complement factor I [ Homo sapiens (human) ] |
Official Symbol | CFI |
Synonyms | FI; IF; KAF; AHUS3; ARMD13; C3BINA; C3b-INA |
Gene ID | 3426 |
mRNA Refseq | NM_000204.5 |
Protein Refseq | NP_000195.3 |
MIM | 217030 |
UniProt ID | P05156 |
◆ Recombinant Proteins | ||
CFI-1531HFL | Recombinant Full Length Human CFI Protein, C-Flag-tagged | +Inquiry |
CFI-1613M | Recombinant Mouse CFI Protein, His (Fc)-Avi-tagged | +Inquiry |
CFI-290H | Recombinant Human CFI protein, His-tagged | +Inquiry |
Cfi-1070M | Recombinant Mouse Cfi protein, His&Myc-tagged | +Inquiry |
CFI-1052H | Recombinant Human CFI protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CFI-105H | Active Native Human Factor I | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFI-7556HCL | Recombinant Human CFI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFI Products
Required fields are marked with *
My Review for All CFI Products
Required fields are marked with *
0
Inquiry Basket