Recombinant Full Length Human CFL1P1 Protein, GST-tagged

• Cat.No.: CFL1P1-3851HF
• Product Overview: Human CFLP1 full-length ORF ( ABM85393.1, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 111 amino acids
• Description: CFL1P1 (Cofilin 1 Pseudogene 1) is a Pseudogene.
• Molecular Mass: 38.61 kDa
• AA Sequence: MGSHVAVFDDVIKVFSDMKVCKSSTLEKVKKRKKLLLFCLSEYKKYIILAEAKKILVSNVDQTIDDPYATFVKMLTVRTAATPLMTPPRTARRRTWCLSSGPLSLHPLRAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CFL1P1 cofilin 1 pseudogene 1 [ Homo sapiens (human) ]
• Official Symbol: CFL1P1
• Synonyms: CFLP1; CFL1P1 cofilin 1 pseudogene 1; CFLP1; cofilin 1 (non-muscle) pseudogene 1; cofilin pseudogene 1
• Gene ID: 142913