Recombinant Human CFL1P1 Protein, GST-tagged
| Cat.No. : | CFL1P1-5221H |
| Product Overview : | Human CFLP1 full-length ORF ( ABM85393.1, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CFL1P1 (Cofilin 1 Pseudogene 1) is a Pseudogene. |
| Molecular Mass : | 38.61 kDa |
| AA Sequence : | MGSHVAVFDDVIKVFSDMKVCKSSTLEKVKKRKKLLLFCLSEYKKYIILAEAKKILVSNVDQTIDDPYATFVKMLTVRTAATPLMTPPRTARRRTWCLSSGPLSLHPLRAK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CFL1P1 cofilin 1 pseudogene 1 [ Homo sapiens (human) ] |
| Official Symbol | CFL1P1 |
| Synonyms | CFLP1; CFL1P1 cofilin 1 pseudogene 1; CFLP1; cofilin 1 (non-muscle) pseudogene 1; cofilin pseudogene 1 |
| Gene ID | 142913 |
| ◆ Recombinant Proteins | ||
| CFL1P1-5221H | Recombinant Human CFL1P1 Protein, GST-tagged | +Inquiry |
| CFL1P1-3851HF | Recombinant Full Length Human CFL1P1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFL1P1 Products
Required fields are marked with *
My Review for All CFL1P1 Products
Required fields are marked with *
