Recombinant Human CFL1P1 Protein, GST-tagged

Cat.No. : CFL1P1-5221H
Product Overview : Human CFLP1 full-length ORF ( ABM85393.1, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CFL1P1 (Cofilin 1 Pseudogene 1) is a Pseudogene.
Molecular Mass : 38.61 kDa
AA Sequence : MGSHVAVFDDVIKVFSDMKVCKSSTLEKVKKRKKLLLFCLSEYKKYIILAEAKKILVSNVDQTIDDPYATFVKMLTVRTAATPLMTPPRTARRRTWCLSSGPLSLHPLRAK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CFL1P1 cofilin 1 pseudogene 1 [ Homo sapiens (human) ]
Official Symbol CFL1P1
Synonyms CFLP1; CFL1P1 cofilin 1 pseudogene 1; CFLP1; cofilin 1 (non-muscle) pseudogene 1; cofilin pseudogene 1
Gene ID 142913

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFL1P1 Products

Required fields are marked with *

My Review for All CFL1P1 Products

Required fields are marked with *

0
cart-icon
0
compare icon