Recombinant Full Length Human CFLAR Protein, GST-tagged
Cat.No. : | CFLAR-3298HF |
Product Overview : | Human CFLAR full-length ORF (AAH01602.1, 1 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 480 amino acids |
Description : | The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists. [provided by RefSeq, Feb 2011] |
Molecular Mass : | 78.43 kDa |
AA Sequence : | MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CFLAR CASP8 and FADD-like apoptosis regulator [ Homo sapiens ] |
Official Symbol | CFLAR |
Synonyms | CFLAR; CASP8 and FADD-like apoptosis regulator; CASP8AP1; c FLIP; CASH; Casper; CLARP; FLAME; FLIP; I FLICE; MRIT; usurpin beta; caspase homolog; inhibitor of FLICE; caspase-eight-related protein; MACH-related inducer of toxicity; FADD-like anti-apoptotic molecule; FADD-like antiapoptotic molecule 1; caspase-related inducer of apoptosis; cellular FLICE-like inhibitory protein; caspase-like apoptosis regulatory protein; FLAME1; c-FLIP; FLAME-1; I-FLICE; c-FLIPL; c-FLIPR; c-FLIPS; |
Gene ID | 8837 |
mRNA Refseq | NM_001127183 |
Protein Refseq | NP_001120655 |
MIM | 603599 |
UniProt ID | O15519 |
◆ Recombinant Proteins | ||
CFLAR-3298HF | Recombinant Full Length Human CFLAR Protein, GST-tagged | +Inquiry |
CFLAR-2722H | Recombinant Human CFLAR Protein (Asp31-Asn184), N-His tagged | +Inquiry |
Cflar-882M | Recombinant Mouse Cflar Protein, MYC/DDK-tagged | +Inquiry |
CFLAR-1176H | Recombinant Human CFLAR Protein, GST-Tagged | +Inquiry |
Cflar-1831M | Recombinant Mouse Cflar protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFLAR-7553HCL | Recombinant Human CFLAR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFLAR Products
Required fields are marked with *
My Review for All CFLAR Products
Required fields are marked with *