Recombinant Full Length Human CGGBP1 Protein, GST-tagged

Cat.No. : CGGBP1-3303HF
Product Overview : Human CGGBP1 full-length ORF (NP_001008391.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 167 amino acids
Description : CGGBP1 influences expression of the FMR1 gene (MIM 309550), which is associated with the fragile X mental retardation syndrome (MIM 300624), by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR.[supplied by OMIM, Mar 2008]
Molecular Mass : 45.2 kDa
AA Sequence : MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CGGBP1 CGG triplet repeat binding protein 1 [ Homo sapiens ]
Official Symbol CGGBP1
Synonyms CGGBP1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGGBP; p20 CGG binding protein; p20 CGGBP; CGG-binding protein 1; p20-CGG binding protein; 20 kDa CGG-binding protein; p20-CGGBP DNA-binding protein; p20-CGGBP;
Gene ID 8545
mRNA Refseq NM_001008390
Protein Refseq NP_001008391
MIM 603363
UniProt ID Q9UFW8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CGGBP1 Products

Required fields are marked with *

My Review for All CGGBP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon