Recombinant Full Length Human CH25H Protein, GST-tagged
| Cat.No. : | CH25H-3305HF |
| Product Overview : | Human CH25H full-length ORF (NP_003947.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 272 amino acids |
| Description : | This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 58.1 kDa |
| AA Sequence : | MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CH25H cholesterol 25-hydroxylase [ Homo sapiens ] |
| Official Symbol | CH25H |
| Synonyms | CH25H; cholesterol 25-hydroxylase; h25OH; cholesterol 25-monooxygenase; C25H; |
| Gene ID | 9023 |
| mRNA Refseq | NM_003956 |
| Protein Refseq | NP_003947 |
| MIM | 604551 |
| UniProt ID | O95992 |
| ◆ Recombinant Proteins | ||
| CH25H-3361M | Recombinant Mouse CH25H Protein | +Inquiry |
| CH25H-1360R | Recombinant Rat CH25H Protein | +Inquiry |
| CH25H-771H | Recombinant Human CH25H Protein, His-tagged | +Inquiry |
| CH25H-660R | Recombinant Rhesus Macaque CH25H Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL32780DF | Recombinant Full Length Danio Rerio Cholesterol 25-Hydroxylase-Like Protein(Ch25H) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CH25H-7549HCL | Recombinant Human CH25H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CH25H Products
Required fields are marked with *
My Review for All CH25H Products
Required fields are marked with *



