Recombinant Full Length Human CH25H Protein, GST-tagged

Cat.No. : CH25H-3305HF
Product Overview : Human CH25H full-length ORF (NP_003947.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 272 amino acids
Description : This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008]
Molecular Mass : 58.1 kDa
AA Sequence : MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CH25H cholesterol 25-hydroxylase [ Homo sapiens ]
Official Symbol CH25H
Synonyms CH25H; cholesterol 25-hydroxylase; h25OH; cholesterol 25-monooxygenase; C25H;
Gene ID 9023
mRNA Refseq NM_003956
Protein Refseq NP_003947
MIM 604551
UniProt ID O95992

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CH25H Products

Required fields are marked with *

My Review for All CH25H Products

Required fields are marked with *

0
cart-icon
0
compare icon