Recombinant Full Length Human CHCHD4 Protein, GST-tagged
| Cat.No. : | CHCHD4-3314HF | 
| Product Overview : | Human CHCHD4 full-length ORF (AAH33775.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 142 amino acids | 
| Description : | CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008] | 
| Molecular Mass : | 42.4 kDa | 
| AA Sequence : | MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CHCHD4 coiled-coil-helix-coiled-coil-helix domain containing 4 [ Homo sapiens ] | 
| Official Symbol | CHCHD4 | 
| Synonyms | CHCHD4; coiled-coil-helix-coiled-coil-helix domain containing 4; mitochondrial intermembrane space import and assembly protein 40; FLJ31709; MIA40; mitochondrial intermembrane space import and assembly 40 homolog (S. cerevisiae); TIMM40; translocase of inner mitochondrial membrane 40 homolog (S. cerevisiae); translocase of inner mitochondrial membrane 40 homolog; coiled-coil-helix-coiled-coil-helix domain-containing protein 4; mitochondrial intermembrane space import and assembly 40 homolog; | 
| Gene ID | 131474 | 
| mRNA Refseq | NM_001098502 | 
| Protein Refseq | NP_001091972 | 
| MIM | 611077 | 
| UniProt ID | Q8N4Q1 | 
| ◆ Recombinant Proteins | ||
| CHCHD4-30197H | Recombinant Human CHCHD4 protein, GST-tagged | +Inquiry | 
| CHCHD4-3215H | Recombinant Human CHCHD4 Protein, MYC/DDK-tagged | +Inquiry | 
| CHCHD4-1022R | Recombinant Rat CHCHD4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CHCHD4-34H | Recombinant Human CHCHD4 protein | +Inquiry | 
| CHCHD4-974Z | Recombinant Zebrafish CHCHD4 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CHCHD4-184HCL | Recombinant Human CHCHD4 lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHCHD4 Products
Required fields are marked with *
My Review for All CHCHD4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            