Recombinant Full Length Human CHCHD4 Protein, GST-tagged
Cat.No. : | CHCHD4-3314HF |
Product Overview : | Human CHCHD4 full-length ORF (AAH33775.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 142 amino acids |
Description : | CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 42.4 kDa |
AA Sequence : | MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHCHD4 coiled-coil-helix-coiled-coil-helix domain containing 4 [ Homo sapiens ] |
Official Symbol | CHCHD4 |
Synonyms | CHCHD4; coiled-coil-helix-coiled-coil-helix domain containing 4; mitochondrial intermembrane space import and assembly protein 40; FLJ31709; MIA40; mitochondrial intermembrane space import and assembly 40 homolog (S. cerevisiae); TIMM40; translocase of inner mitochondrial membrane 40 homolog (S. cerevisiae); translocase of inner mitochondrial membrane 40 homolog; coiled-coil-helix-coiled-coil-helix domain-containing protein 4; mitochondrial intermembrane space import and assembly 40 homolog; |
Gene ID | 131474 |
mRNA Refseq | NM_001098502 |
Protein Refseq | NP_001091972 |
MIM | 611077 |
UniProt ID | Q8N4Q1 |
◆ Recombinant Proteins | ||
CHCHD4-1209H | Recombinant Human CHCHD4 Protein, GST-Tagged | +Inquiry |
CHCHD4-1097H | Recombinant Human CHCHD4 Protein (1-142 aa), His-SUMO-tagged | +Inquiry |
CHCHD4-1627M | Recombinant Mouse CHCHD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHCHD4-1364R | Recombinant Rat CHCHD4 Protein | +Inquiry |
CHCHD4-3314HF | Recombinant Full Length Human CHCHD4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHCHD4-184HCL | Recombinant Human CHCHD4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHCHD4 Products
Required fields are marked with *
My Review for All CHCHD4 Products
Required fields are marked with *
0
Inquiry Basket