Recombinant Full Length Human CHORDC1 Protein, GST-tagged
Cat.No. : | CHORDC1-3213HF |
Product Overview : | Human CHORDC1 full-length ORF (AAH72461.1, 1 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 332 amino acids |
Description : | CHORDC1 (Cysteine And Histidine Rich Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include Hsp90 protein binding. An important paralog of this gene is ITGB1BP2. |
Molecular Mass : | 63.9 kDa |
AA Sequence : | MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPAAKKQEKQKDATTD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHORDC1 cysteine and histidine-rich domain (CHORD) containing 1 [ Homo sapiens ] |
Official Symbol | CHORDC1 |
Synonyms | CHORDC1; cysteine and histidine-rich domain (CHORD) containing 1; cysteine and histidine rich domain (CHORD) containing 1, cysteine and histidine rich domain (CHORD) containing, zinc binding protein 1; cysteine and histidine-rich domain-containing protein 1; CHP1; CHP-1; protein morgana; CHORD-containing protein 1; chord domain-containing protein 1; cysteine and histidine-rich domain (CHORD)-containing 1; cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1; FLJ37289; |
Gene ID | 26973 |
mRNA Refseq | NM_001144073 |
Protein Refseq | NP_001137545 |
MIM | 604353 |
UniProt ID | Q9UHD1 |
◆ Recombinant Proteins | ||
CHORDC1-2528C | Recombinant Chicken CHORDC1 | +Inquiry |
CHORDC1-407C | Recombinant Cynomolgus CHORDC1 Protein, His-tagged | +Inquiry |
CHORDC1-1655M | Recombinant Mouse CHORDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHORDC1-680R | Recombinant Rhesus Macaque CHORDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHORDC1-1038R | Recombinant Rat CHORDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHORDC1 Products
Required fields are marked with *
My Review for All CHORDC1 Products
Required fields are marked with *
0
Inquiry Basket