Recombinant Human CHORDC1 Protein, GST-Tagged
| Cat.No. : | CHORDC1-1260H |
| Product Overview : | Human CHORDC1 full-length ORF (AAH72461.1, 1 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CHORDC1 (Cysteine And Histidine Rich Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include Hsp90 protein binding. An important paralog of this gene is ITGB1BP2. |
| Molecular Mass : | 63.9 kDa |
| AA Sequence : | MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPAAKKQEKQKDATTD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHORDC1 cysteine and histidine-rich domain (CHORD) containing 1 [ Homo sapiens ] |
| Official Symbol | CHORDC1 |
| Synonyms | CHORDC1; cysteine and histidine-rich domain (CHORD) containing 1; cysteine and histidine rich domain (CHORD) containing 1, cysteine and histidine rich domain (CHORD) containing, zinc binding protein 1; cysteine and histidine-rich domain-containing protein 1; CHP1; CHP-1; protein morgana; CHORD-containing protein 1; chord domain-containing protein 1; cysteine and histidine-rich domain (CHORD)-containing 1; cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1; FLJ37289; |
| Gene ID | 26973 |
| mRNA Refseq | NM_001144073 |
| Protein Refseq | NP_001137545 |
| MIM | 604353 |
| UniProt ID | Q9UHD1 |
| ◆ Recombinant Proteins | ||
| CHORDC1-1380R | Recombinant Rat CHORDC1 Protein | +Inquiry |
| Chordc1-2154M | Recombinant Mouse Chordc1 Protein, Myc/DDK-tagged | +Inquiry |
| CHORDC1-3213HF | Recombinant Full Length Human CHORDC1 Protein, GST-tagged | +Inquiry |
| CHORDC1-3229H | Recombinant Human CHORDC1 Protein, MYC/DDK-tagged | +Inquiry |
| CHORDC1-1655M | Recombinant Mouse CHORDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHORDC1 Products
Required fields are marked with *
My Review for All CHORDC1 Products
Required fields are marked with *
