Recombinant Human CHORDC1 Protein, GST-Tagged

Cat.No. : CHORDC1-1260H
Product Overview : Human CHORDC1 full-length ORF (AAH72461.1, 1 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CHORDC1 (Cysteine And Histidine Rich Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include Hsp90 protein binding. An important paralog of this gene is ITGB1BP2.
Molecular Mass : 63.9 kDa
AA Sequence : MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPAAKKQEKQKDATTD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHORDC1 cysteine and histidine-rich domain (CHORD) containing 1 [ Homo sapiens ]
Official Symbol CHORDC1
Synonyms CHORDC1; cysteine and histidine-rich domain (CHORD) containing 1; cysteine and histidine rich domain (CHORD) containing 1, cysteine and histidine rich domain (CHORD) containing, zinc binding protein 1; cysteine and histidine-rich domain-containing protein 1; CHP1; CHP-1; protein morgana; CHORD-containing protein 1; chord domain-containing protein 1; cysteine and histidine-rich domain (CHORD)-containing 1; cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1; FLJ37289;
Gene ID 26973
mRNA Refseq NM_001144073
Protein Refseq NP_001137545
MIM 604353
UniProt ID Q9UHD1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHORDC1 Products

Required fields are marked with *

My Review for All CHORDC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon