Recombinant Full Length Human CHURC1 Protein, GST-tagged

Cat.No. : CHURC1-1837HF
Product Overview : Human CHURC1 full-length ORF ( AAH20550, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 112 amino acids
Description : CHURC1 (Churchill Domain Containing 1) is a Protein Coding gene.
Molecular Mass : 38.06 kDa
AA Sequence : MCGDCVGKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHURC1 churchill domain containing 1 [ Homo sapiens ]
Official Symbol CHURC1
Synonyms CHURC1; churchill domain containing 1; C14orf52; protein Churchill; FLJ33064; My015; chch; FLJ51978; FLJ78804
Gene ID 91612
mRNA Refseq NM_001204063
Protein Refseq NP_001190992
MIM 608577
UniProt ID Q8WUH1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHURC1 Products

Required fields are marked with *

My Review for All CHURC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon