Recombinant Full Length Human CHURC1 Protein, GST-tagged

• Cat.No.: CHURC1-1837HF
• Product Overview: Human CHURC1 full-length ORF ( AAH20550, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 112 amino acids
• Description: CHURC1 (Churchill Domain Containing 1) is a Protein Coding gene.
• Molecular Mass: 38.06 kDa
• AA Sequence: MCGDCVGKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHURC1 churchill domain containing 1 [ Homo sapiens ]
• Official Symbol: CHURC1
• Synonyms: CHURC1; churchill domain containing 1; C14orf52; protein Churchill; FLJ33064; My015; chch; FLJ51978; FLJ78804
• Gene ID: 91612
• mRNA Refseq: NM_001204063
• Protein Refseq: NP_001190992
• MIM: 608577
• UniProt ID: Q8WUH1