Recombinant Full Length Human CHURC1 Protein, GST-tagged
Cat.No. : | CHURC1-1837HF |
Product Overview : | Human CHURC1 full-length ORF ( AAH20550, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 112 amino acids |
Description : | CHURC1 (Churchill Domain Containing 1) is a Protein Coding gene. |
Molecular Mass : | 38.06 kDa |
AA Sequence : | MCGDCVGKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHURC1 churchill domain containing 1 [ Homo sapiens ] |
Official Symbol | CHURC1 |
Synonyms | CHURC1; churchill domain containing 1; C14orf52; protein Churchill; FLJ33064; My015; chch; FLJ51978; FLJ78804 |
Gene ID | 91612 |
mRNA Refseq | NM_001204063 |
Protein Refseq | NP_001190992 |
MIM | 608577 |
UniProt ID | Q8WUH1 |
◆ Recombinant Proteins | ||
CHURC1-1766Z | Recombinant Zebrafish CHURC1 | +Inquiry |
CHURC1-1352H | Recombinant Human CHURC1 Protein, GST-tagged | +Inquiry |
CHURC1-1683M | Recombinant Mouse CHURC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHURC1-6274C | Recombinant Chicken CHURC1 | +Inquiry |
CHURC1-3463M | Recombinant Mouse CHURC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHURC1-7502HCL | Recombinant Human CHURC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHURC1 Products
Required fields are marked with *
My Review for All CHURC1 Products
Required fields are marked with *
0
Inquiry Basket