Recombinant Full Length Human CIB4 Protein, GST-tagged
Cat.No. : | CIB4-1846HF |
Product Overview : | Human CIB4 full-length ORF ( NP_001025052.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 185 amino acids |
Description : | CIB4 (Calcium And Integrin Binding Family Member 4) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CIB1. |
Molecular Mass : | 48.1 kDa |
AA Sequence : | MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSHKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CIB4 calcium and integrin binding family member 4 [ Homo sapiens (human) ] |
Official Symbol | CIB4 |
Synonyms | CIB4; calcium and integrin binding family member 4; Calcium And Integrin Binding Family Member 4; Calcium And Integrin-Binding Family Member 4; KIP4; calcium and integrin-binding family member 4 |
Gene ID | 130106 |
mRNA Refseq | NM_001029881 |
Protein Refseq | NP_001025052 |
MIM | 610646 |
UniProt ID | A0PJX0 |
◆ Recombinant Proteins | ||
CIB4-1688M | Recombinant Mouse CIB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CIB4-3469M | Recombinant Mouse CIB4 Protein | +Inquiry |
CIB4-1360H | Recombinant Human CIB4 Protein, GST-tagged | +Inquiry |
CIB4-1846HF | Recombinant Full Length Human CIB4 Protein, GST-tagged | +Inquiry |
Cib4-788M | Recombinant Mouse Cib4 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIB4-357HCL | Recombinant Human CIB4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIB4 Products
Required fields are marked with *
My Review for All CIB4 Products
Required fields are marked with *