Recombinant Full Length Human CIB4 Protein, GST-tagged

• Cat.No.: CIB4-1846HF
• Product Overview: Human CIB4 full-length ORF ( NP_001025052.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 185 amino acids
• Description: CIB4 (Calcium And Integrin Binding Family Member 4) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CIB1.
• Molecular Mass: 48.1 kDa
• AA Sequence: MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSHKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CIB4 calcium and integrin binding family member 4 [ Homo sapiens (human) ]
• Official Symbol: CIB4
• Synonyms: CIB4; calcium and integrin binding family member 4; Calcium And Integrin Binding Family Member 4; Calcium And Integrin-Binding Family Member 4; KIP4; calcium and integrin-binding family member 4
• Gene ID: 130106
• mRNA Refseq: NM_001029881
• Protein Refseq: NP_001025052
• MIM: 610646
• UniProt ID: A0PJX0